Protein Info for AMB_RS01635 in Magnetospirillum magneticum AMB-1

Annotation: chemotaxis response regulator protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00072: Response_reg" amino acids 15 to 125 (111 residues), 83.4 bits, see alignment E=1.3e-27 PF01339: CheB_methylest" amino acids 194 to 373 (180 residues), 197.9 bits, see alignment E=1.1e-62

Best Hits

Swiss-Prot: 100% identical to CHEB1_MAGSA: Protein-glutamate methylesterase/protein-glutamine glutaminase 1 (cheB1) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to mag:amb0323)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAJ8 at UniProt or InterPro

Protein Sequence (381 amino acids)

>AMB_RS01635 chemotaxis response regulator protein-glutamate methylesterase (Magnetospirillum magneticum AMB-1)
MAIDSPSPATDSIRVMLVDDSAVVRGLVTRILEGEAGIQVVASVGNGQMALASLERNEID
VVILDIEMPVMDGLTALPKLLQIDPGLKVIMQSTLTLKGADVSLRAMQMGAADYIPKPTS
TRDLAGGVDFKSELVTKIRALGQARRAGARPARPGGPPATRPVIASTSPRTPVPIHPPGP
LQLRSNTPEPPDIIAIGSSTGGPQALFTVLGTMKAGTVRQPIVITQHMPATFTTILAEHI
GRVSGWEAREAQDGEAIRGGRVYIAPGDFHMVVETKGTDKVLRLNKNPPENFCRPAVDPM
LRSIAAAYGKRVLACILTGMGADGMKGGQAVVASGGTVIAQDEASSVVWGMPGAAATAGI
CSAVLPLPEIAPWIMKLAARR