Protein Info for AMB_RS01410 in Magnetospirillum magneticum AMB-1

Annotation: cobalt ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR01166: cobalt ABC transporter, ATP-binding protein" amino acids 12 to 201 (190 residues), 265.7 bits, see alignment E=9.3e-84 PF00005: ABC_tran" amino acids 19 to 167 (149 residues), 105.8 bits, see alignment E=2.9e-34 PF13304: AAA_21" amino acids 136 to 197 (62 residues), 31.4 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 68% identical to CBIO_RHOCB: Cobalt import ATP-binding protein CbiO (cbiO) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 100% identity to mag:amb0278)

Predicted SEED Role

"ATPase component CbiO of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAP3 at UniProt or InterPro

Protein Sequence (264 amino acids)

>AMB_RS01410 cobalt ABC transporter (Magnetospirillum magneticum AMB-1)
MILEAAGLTYRYPGGVAALSGLDLGVERGRRLAVLGPNGAGKTTLLLHLNGTLKPSAGTV
RLGGEIMGYSRAALTGWRRRVGLVLQEPDDQLFAATVAEDVSFGPLNLGLSEAETRRRVE
AALDALGISDLAGRATHMLSFGQKKRVAIAGALAMEPEVLLLDEPLAGLDHQGGKRLLAA
LDALARAGTTLVFTTHEVDLAHGFADRVALFRDGRVIAQGEAAEVLSDRECLAACGLEMP
LLLELGVRTRDEALALLAVGRKVY