Protein Info for AMB_RS01400 in Magnetospirillum magneticum AMB-1

Annotation: energy-coupling factor ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 63 to 82 (20 residues), see Phobius details PF02553: CbiN" amino acids 7 to 71 (65 residues), 73.4 bits, see alignment E=5.8e-25

Best Hits

Swiss-Prot: 45% identical to CBIN_CLOPE: Cobalt transport protein CbiN (cbiN) from Clostridium perfringens (strain 13 / Type A)

KEGG orthology group: K02009, cobalt transport protein (inferred from 100% identity to mag:amb0276)

Predicted SEED Role

"Additional substrate-specific component CbiN of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAP5 at UniProt or InterPro

Protein Sequence (90 amino acids)

>AMB_RS01400 energy-coupling factor ABC transporter substrate-binding protein (Magnetospirillum magneticum AMB-1)
MSARTNSMLLGVAALIIAAPLVLNPAGQFGGTDDAASEVVTSSHPAYEKWTGPLWQPSKE
IEGLLFAAQAAFGAGLLGYVIGRRHGRSGK