Protein Info for AMB_RS01385 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF13755: Sensor_TM1" amino acids 16 to 71 (56 residues), 59.3 bits, see alignment 6.1e-20 PF13756: Stimulus_sens_1" amino acids 85 to 197 (113 residues), 88.9 bits, see alignment E=7.8e-29 PF00672: HAMP" amino acids 255 to 308 (54 residues), 42.1 bits, see alignment 2.3e-14 PF00512: HisKA" amino acids 315 to 378 (64 residues), 48.2 bits, see alignment E=2.3e-16 PF02518: HATPase_c" amino acids 426 to 536 (111 residues), 92.2 bits, see alignment E=7.5e-30

Best Hits

KEGG orthology group: K14980, two-component system, OmpR family, sensor histidine kinase ChvG [EC: 2.7.13.3] (inferred from 100% identity to mag:amb0273)

Predicted SEED Role

"Sensor histidine kinase ChvG (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAP8 at UniProt or InterPro

Protein Sequence (537 amino acids)

>AMB_RS01385 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MTSEATAPRRRLPRWRLLASPLTRRILAVNLLAPIVLVVGVMYLDRYKQGLIRAELDGLG
TQAEMVAGAIGEGAVFEEEMGFFEINPAMAQQMVRRLSEPAKFRARLFGAVGELAADSRV
VGGAKGSIYIEELPPPTPRHWTDRLARQWDRWARWMPRDESLPLYRDIANARADDFEEAM
SAMAGRAAWAVRTRKNGTLMLSVAVPVQRYKQVVGALLITADGTNIARSLFQVRIAILQA
FAVSLALTIGVSLYMAGTIARPIRRLALAAERVRHGQGRVHAIPDLSHRKDEIGELSVAL
KEMTEALWRRMDAIEAFAADVAHEIKNPLTSLRSAVETAARIEDPDKRARLMSIVLDDVG
RLDRLISDISDASHIDAEMSRAETGPVALAAMLDTLAEIYRGTCEDRGLRFEVERPEGDA
LTVQGIESRLVQVLRNLIANAASFSPDGGLIRLAAHRDGGRIALVVEDQGPGIPANKLDA
IFERFYSERPEGEKFGTHSGLGLSISRQIVEAHGGAIRAENRDEGGARFTVDIPAAP