Protein Info for AMB_RS01330 in Magnetospirillum magneticum AMB-1

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 173 to 206 (34 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details PF13231: PMT_2" amino acids 64 to 234 (171 residues), 31.5 bits, see alignment E=9.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0262)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAQ9 at UniProt or InterPro

Protein Sequence (547 amino acids)

>AMB_RS01330 glycosyltransferase family 39 protein (Magnetospirillum magneticum AMB-1)
MERLTGGIRPYLLLSLLSLFVYLPGLVALPPMDRDESRFVQATRQMLETGDYIRIQFQQE
MRAKKPVGAYWLQAASVSLLSDKATRDVWPYRLPSALAAWGAVLMTFAFGQYLFGRQTAL
IGAALLGTSLMLVSEAHQAKTDAIMLATAVAAQGALARFYLGGKGQGAVPGPLIALVFWV
AIGASILLKGPVIPAITILTILALGFADRQWAWLVGLRPFTGLIVAASIAAPWFVAISQA
TGGAFVGEAVKGDLLPKLLGAQESHGGLPGTYLALAAVILWPGSLLLWPSLTAAWKVRLR
PEIRFCLAWIIPAWVMFEIVPTKLPHYVLPTFPALALLMAVAVVGRAPDLWSRPAKAWYG
LWCVIGLALAAAVVILPHQFAPTLPLMSIPSALLIAGTALAAAWLAFKEQMRPAVMALVL
TAVTSFQVVFEGVLPGLDYLFVSRQAAELVANRPHRGAVVVAGYAEPSLVFLLGTDTVLT
SGEAAAQHLTNGPAALTLVSDREEEKFFAAAAQIGVKPVVVGVVKGFNYSRGRKVTLTAY
AVEGKAP