Protein Info for AMB_RS01280 in Magnetospirillum magneticum AMB-1

Annotation: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02798: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase
  • amino acids 9 to 230 (222 residues), 414.3 bits, E=6e-129
• PF03737: RraA-like
  • amino acids 32 to 179 (148 residues), 148.3 bits, E=1.1e-47

Best Hits

Swiss-Prot: 73% identical to HMGA_PSEOC: 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase (proA) from Pseudomonas straminea

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 100% identity to mag:amb0252)

MetaCyc: 73% identical to 4-oxalocitramalate aldolase subunit (Pseudomonas straminea)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]; Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 4.1.3.17, 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• TCA cycle V (2-oxoglutarate synthase) (9/9 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (8/8 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• methylgallate degradation (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• gluconeogenesis III (10/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• superpathway of vanillin and vanillate degradation (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• gluconeogenesis I (10/13 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• gallate degradation II (4/5 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• methylaspartate cycle (14/19 steps found)
• D-malate degradation (1/1 steps found)
• gallate degradation I (3/4 steps found)
• glyoxylate cycle (4/6 steps found)
• 4-hydroxy-4-methyl-L-glutamate biosynthesis (1/2 steps found)
• reductive TCA cycle II (8/12 steps found)
• syringate degradation (8/12 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (9/14 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• chitin deacetylation (1/4 steps found)
• gentisate degradation II (1/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• mixed acid fermentation (9/16 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Carbon fixation in photosynthetic organisms
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.40, 1.1.1.83

Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 4.1.1.112 or 4.1.3.17

Sequence Analysis Tools

See Q2WAR9 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AMB_RS01280 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase (Magnetospirillum magneticum AMB-1)
MIMSMNNLGIVKRNIVRADKAAVEKLSRFGVATIHEAMGRVGLMKPYMRPIYTGAHLCGT
AVTVLLHPGDNWMMHVAAEQIQPGDVVIAAVTADCTDGFFGDLLATSFRARGAVGLVIDA
GVRDVKDLTAMNFPVFSKAISAKGTIKATLGSVNIPVVCAGAAVNPGDVVIADDDGVVVV
PAPIAQAAADAAQAREDNEAAKRARLAAGELGLDMYKMREALAAAGLKYVD