Protein Info for AMB_RS01170 in Magnetospirillum magneticum AMB-1

Annotation: copper export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 349 to 366 (18 residues), see Phobius details amino acids 376 to 393 (18 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details amino acids 443 to 460 (18 residues), see Phobius details amino acids 472 to 492 (21 residues), see Phobius details amino acids 504 to 523 (20 residues), see Phobius details PF05425: CopD" amino acids 194 to 288 (95 residues), 57 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 100% identity to mag:amb0230)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAU1 at UniProt or InterPro

Protein Sequence (527 amino acids)

>AMB_RS01170 copper export protein (Magnetospirillum magneticum AMB-1)
MLTTLPPDILAFFAVILRGLQLTAQSVILGGVLFLLGFTRPMALKLGGRAAALERTGMDW
TAKAGFALVVVAGLSIFASLAQLVAGLEIQPADAMGADFVQWTLIMAVAAFALAVTARMG
ANPAQVSSLALLAVVVLGASVMSSHAFARVEERNYYILADALHQAGASLWIGGIPFMLLA
LSKVTGSKDRLMVGMRFSHLFTGAVGLLLLGAGMLAWGYISTPGALIGTAYGIMTGAKII
LLSVLLLLAALNRKSTRSEAEDKGQFRLRRFAEVEIGIGITVLMIAASMASQPPAVDQLQ
YQASVGEIVERMAPVRPPRVVSPPSEHLTLGEKTAASDTADKMWSEFNHNWAGIFVFAMG
LGAMANRMGVKAARHWPLLFLVIGGAIIIRSDPESWPIGPRGFFETLADPEVFQHRVVGL
LLFPFGLFEWAVRTGRLKSERAALIFPILCAVGAGLLLVHNHTLTDVKERFLIEFSHIPM
GLFGVLSGWLRWLEIRGDGRAKQVAGLLWPLCFSMVGVLLMFYRELP