Protein Info for AMB_RS01120 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 807 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 297 to 317 (21 residues), see Phobius details PF00672: HAMP" amino acids 315 to 365 (51 residues), 39.5 bits, see alignment 8.7e-14 PF00015: MCPsignal" amino acids 468 to 632 (165 residues), 117 bits, see alignment E=1.3e-37 TIGR02481: hemerythrin-like metal-binding domain" amino acids 676 to 800 (125 residues), 100.5 bits, see alignment E=3.7e-33 PF01814: Hemerythrin" amino acids 686 to 798 (113 residues), 58.1 bits, see alignment E=2e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0220)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAV1 at UniProt or InterPro

Protein Sequence (807 amino acids)

>AMB_RS01120 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MFNLNVSGRIYAGFGLIVLLLLVLAGQSITTLGSSKAQIDRYAGVSDNAQRVLSLKGDFA
NIRRNVIIFADNADPKALEQIRKIQPGMAKTLPEAANATVDPTRKANLTKMGELFTGYMA
GFDKVADLRKAKLELVEKRMNVVGVAARKDLSQIMKTAMDDGDYEAAALAGVAQEALLLG
RLNAIKFLADPSDALVKDAQTEIEEFVKEAETLTKRLRNPERKRLAAEAETNAKAYRDAF
TQVAAATNALDKLVFKDMAALAVQFADLADQTVHSQDQAMDQQKADTEAGMARSNTATWT
GAIIALGLAVLLSWLIARSIVTPLSAMTGAMTELSKGNKTVDIPARERTDEIGAMAQAME
IFKENTLKMDKMQAEQEAQKVKAEADRKAALHHMADTFEESVGKVVQTVTSAATELQGAS
SQMAGTAHETSAQATTVASAATQASANVETVAAATEELAASISEIAKQVERSQAVANRAE
QEAENTTNQVRALSDNVGRIGEVVVLINDIAAQTNLLALNATIEAARAGDAGKGFAVVAN
EVKNLANQTAKATDEIASQIKAVQEGTGNAVKAIDTISKVISEMGEISASVASAVQEQTA
ATGEIARNVEQAAAGTAEVSSNINSVEQAARETGHAAEQISESATDLSKQAEFLRGEVGR
FLHQVRADKADMRILEWENALNTGESSIDRHHREMFDQVNRFYGEMMSGNGDAAIQGILG
LVPAAFVPHFKEEEELMTRHAYPGIDEHRRRHREFMDKFEGLKRAVETGKDGANGQLFQF
VAGWLKDHIRHEDGKIAAFLRDKKIVA