Protein Info for AMB_RS01090 in Magnetospirillum magneticum AMB-1

Annotation: tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR01579: MiaB-like tRNA modifying enzyme" amino acids 42 to 439 (398 residues), 432.6 bits, see alignment E=2e-133 PF00919: UPF0004" amino acids 42 to 127 (86 residues), 66.3 bits, see alignment E=2e-22 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 42 to 449 (408 residues), 347.7 bits, see alignment E=9e-108 PF04055: Radical_SAM" amino acids 172 to 345 (174 residues), 81.2 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0214)

Predicted SEED Role

"tRNA-t(6)A37 methylthiotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAV7 at UniProt or InterPro

Protein Sequence (452 amino acids)

>AMB_RS01090 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB (Magnetospirillum magneticum AMB-1)
MSEAKPSAGALSDPERSGGAKGARARPASEGQTLTSNTPPTILTFGCRLNAYESEVMKEH
AKATESGVETVIVNTCAVTAEAERQARQAIRKIRRERPDARIVVTGCAAQAHPETFDAMP
EIDQILGNAEKMQPDIFAAPPAERIVVGDIMEVREVASHLVSGFEGRARAFVEVQQGCDH
RCTFCIIPFGRGPNRSVPMGRIVEQIKELVAGGFNEVVLTGVDVTAYGADLPGKPGLGQL
VRRLLAALPELPRLRLSSLDPVEVDEDLLAAIASEARLLPHFHLSVQAGDDTILKRMKRR
HLRGDVITLAARIRALRPDAVLGADIIAGFPTEDEEMFQHSLDLVDEAGLTHLHVFPFSA
RPGTPAARMPKVKGDVVKERAARLRAKGAAAMAAFLATRIGGVESVLIEKDGKGHSAHYL
PVRVAGCAAEPGTILNVRITSVDGDELVGELA