Protein Info for AMB_RS00940 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF08448: PAS_4" amino acids 19 to 112 (94 residues), 29.9 bits, see alignment E=1.1e-10 PF13426: PAS_9" amino acids 20 to 111 (92 residues), 33.2 bits, see alignment E=1.1e-11 TIGR00229: PAS domain S-box protein" amino acids 21 to 112 (92 residues), 41.7 bits, see alignment E=5.7e-15 PF00989: PAS" amino acids 21 to 111 (91 residues), 39.2 bits, see alignment E=1.3e-13 PF08447: PAS_3" amino acids 31 to 113 (83 residues), 47.6 bits, see alignment E=3.4e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to mag:amb0185)

Predicted SEED Role

"putative sensor (PAS) domain for methyl-accepting chemotaxis sensory transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WAY6 at UniProt or InterPro

Protein Sequence (176 amino acids)

>AMB_RS00940 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MAIDRSLTNVERTFQWDDVIVSKTDLTGKITYANDVFLGISGYTEEELLGAPHSILRHPA
MPRCVFKFLWDRIAQGHEVFAYVINRAKNGDHYWVFAHVTPCYDQAGKMVGYHSNRRVPK
AEAVATVKPLYETLLGIENAAPDRKQGVEQSFAALVKTIGDLGFDSYDRLVMTISR