Protein Info for AMB_RS00830 in Magnetospirillum magneticum AMB-1

Annotation: ammonia monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 22 (4 residues), see Phobius details amino acids 29 to 46 (18 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 7 to 162 (156 residues), 125.5 bits, see alignment E=8.1e-41 amino acids 186 to 341 (156 residues), 118.4 bits, see alignment E=1.3e-38 PF05145: AbrB" amino acids 30 to 341 (312 residues), 267.8 bits, see alignment E=5.4e-84

Best Hits

KEGG orthology group: K07120, (no description) (inferred from 100% identity to mag:amb0163)

Predicted SEED Role

"bll1341; hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB08 at UniProt or InterPro

Protein Sequence (348 amino acids)

>AMB_RS00830 ammonia monooxygenase (Magnetospirillum magneticum AMB-1)
MIRLRSWAVALGLGGVGGSLFAALDLPLPWMLGALTAVTLASLGGLRPEIPASMRSVMIA
VLGLMLGSAFSPDLLARIGRWSDSLLVLTLATLASGLLVTFYLRRTSKMSRVTAFFAAAP
GGINEMVLTGGAMGGDERTIALSHSLRILLIVFTVPFGYRLIAHVHSVPMAESMGRLADL
GGMDALVMLGSAVAGAALARLARLPAWMLTGPMLSSAGLHLAGLTAFRPPAELVVLAQLV
TGASIGCRFRGLSWSDMAGMARPAMGATAIMLVLSAGAAGLLAAGGHSSFGVLLLAFVPG
GIAEMCLVALALGQDVAFVSTHHVVRVVMVIMLAPPIFKLLERRESRR