Protein Info for AMB_RS00780 in Magnetospirillum magneticum AMB-1
Annotation: GTP 3',8-cyclase MoaA
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to MOAA_RHILO: GTP 3',8-cyclase (moaA) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to mag:amb0153)Predicted SEED Role
"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2WB18 at UniProt or InterPro
Protein Sequence (328 amino acids)
>AMB_RS00780 GTP 3',8-cyclase MoaA (Magnetospirillum magneticum AMB-1) MIDPFGRKVSYLRVSVTDRCDLRCVYCMAEDMHFLPKADILSLEELERLCGAFVRSGVRK LRLTGGEPLVRRNIMSLITNLGRLVKSGELDELTLTTNATQLAKHADGLAAAGVKRLNVS LDSLDPAKFEAITRWGKLDQVLDGIMAAKAAGLAVKINTVALKGGNEDEHEHLVEWCGRH GFDLTFIETMPMGDIHSDRTEQYLPLSLVRSRLEQRFTLSEIDYRTGGPARYVRVAETGG RIGFITPMTHNFCETCNRVRVTCTGTLYMCLGQEDAADLRTPLRASEGDQLLEAAIAEAI SRKPKGHDFIIDRDSRPAVSRHMSVTGG