Protein Info for AMB_RS00735 in Magnetospirillum magneticum AMB-1

Annotation: glycosyltransferase WbuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 85 to 101 (17 residues), see Phobius details amino acids 115 to 127 (13 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 17 to 200 (184 residues), 72.5 bits, see alignment E=1.3e-23 PF13439: Glyco_transf_4" amino acids 18 to 203 (186 residues), 64.1 bits, see alignment E=4.2e-21 PF00534: Glycos_transf_1" amino acids 217 to 379 (163 residues), 67.2 bits, see alignment E=3.4e-22 PF13692: Glyco_trans_1_4" amino acids 225 to 371 (147 residues), 58.8 bits, see alignment E=1.9e-19 PF13524: Glyco_trans_1_2" amino acids 251 to 396 (146 residues), 35.2 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0145)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB26 at UniProt or InterPro

Protein Sequence (419 amino acids)

>AMB_RS00735 glycosyltransferase WbuB (Magnetospirillum magneticum AMB-1)
MRILFLTENYPPETNAAATRVSERAAYWIKAGHQVTVLTSAPNFPGGRLFEGWRNDWRQI
SVVDGIRVVRVKTYIAPNEGFAKRILDFLSFMVSAFIAGLFEARPDVVVSTSPQFFAAVG
GWALAAVRRVPFVFELGDLWPRSITAVGAMKDSPVIRAIEALELFLYRRSAAVVALTRAF
KADLIARRIPAEKIAVVINGVDLPRYAPRPRDEALEAEWGLKDKFVIGYVGTHGMAHGLI
NVLDAALRLKDTAPHIRFLLVGNGAERQMLKDEAARRGLANVVFGPPQPKERMPAVWSLC
DVALIHLKDSPAFAEVIPSKMFEAMGMGLPLLLVAPRGEASHIVEADRAGLFVPAADPDG
LAAAARRLADDAAERKTLAAASLEAASSHTRQRQADLFIRVLELVVAGRGSAEAGTIEG