Protein Info for AMB_RS00705 in Magnetospirillum magneticum AMB-1

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF08421: Methyltransf_13" amino acids 11 to 72 (62 residues), 77.2 bits, see alignment E=2.1e-25 PF13489: Methyltransf_23" amino acids 90 to 246 (157 residues), 55.5 bits, see alignment E=1.4e-18 PF08241: Methyltransf_11" amino acids 109 to 203 (95 residues), 31.1 bits, see alignment E=7.4e-11 PF08242: Methyltransf_12" amino acids 109 to 201 (93 residues), 38.8 bits, see alignment E=3.2e-13 PF08484: Methyltransf_14" amino acids 252 to 409 (158 residues), 177.2 bits, see alignment E=5.5e-56

Best Hits

Swiss-Prot: 39% identical to NOVU_STRNV: C-methyltransferase NovU (novU) from Streptomyces niveus

KEGG orthology group: None (inferred from 100% identity to mag:amb0140)

MetaCyc: 43% identical to D-olivose 4-ketoreductase (Streptomyces argillaceus)
2.1.1.-; 1.1.1.-

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB31 at UniProt or InterPro

Protein Sequence (414 amino acids)

>AMB_RS00705 class I SAM-dependent methyltransferase (Magnetospirillum magneticum AMB-1)
MSTQHHRRPTCRLCGGKRLTEVVKLVPTPPANAFVPASELDREQERFPLDVFFCEDCAHV
QLLDVVDPRVLFEHYVYVSGTSPVFVRHFEDYAAFVMERFKPVAGGLVLDIGSNDGTLLS
FFQKAGMRVLGIDPAQEISAEATARGIPTICGFFGADKGAEIAAAHGKAEVITANNVFAH
IDDLSGVVDGVRGLLSPSGVFVFEVSYLVDVFENTLFDTIYHEHLDYHSVKPLIRFFAAK
GMELVEAIRVGSHGGSLRGIAQLKGGPHAVGASVAEAVALEERLGLDRAATLAKFAADIE
ALGAELNAVLKSLKAAGKRVGAFGAPAKATTLMYHFGIGPELVDFIIDDSPLKQGLYSPG
MHIPVVSSADGFAKKPDYLVILAWNFAKAIIDKNAAFRSGGGKFIIPIPKVEVV