Protein Info for AMB_RS00700 in Magnetospirillum magneticum AMB-1

Annotation: nucleoside-diphosphate sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 29 to 273 (245 residues), 151.6 bits, E=5.1e-48
• PF16363: GDP_Man_Dehyd
  • amino acids 30 to 340 (311 residues), 105.3 bits, E=9.8e-34
• PF01073: 3Beta_HSD
  • amino acids 31 to 294 (264 residues), 45.7 bits, E=8.8e-16
• PF07993: NAD_binding_4
  • amino acids 98 to 211 (114 residues), 24.3 bits, E=3.4e-09

Best Hits

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to mag:amb0139)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (3/5 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
• dTDP-N-acetylthomosamine biosynthesis (2/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (3/6 steps found)
• dTDP-D-desosamine biosynthesis (3/6 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (5/9 steps found)
• dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (4/8 steps found)
• dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
• dTDP-β-L-olivose biosynthesis (3/7 steps found)
• dTDP-β-L-megosamine biosynthesis (3/8 steps found)
• dTDP-β-L-mycarose biosynthesis (2/7 steps found)
• dTDP-α-D-forosamine biosynthesis (3/9 steps found)
• superpathway of enterobacterial common antigen biosynthesis (3/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of erythromycin biosynthesis (3/19 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (5/23 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• superpathway of megalomicin A biosynthesis (4/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of vancomycin group antibiotics
• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

See Q2WB32 at UniProt or InterPro

Protein Sequence (353 amino acids)

>AMB_RS00700 nucleoside-diphosphate sugar epimerase (Magnetospirillum magneticum AMB-1)
MAEFLLKSDIAEICERLGDTAQDFAGKTVLLTGGRGFLGRYFMEIFAHLNQHILKKPVKL
VAADNLITAGKEGANVAEYPHTEFIQHDVIQPLKWKGSLDYVIHAAGIASPFYYRAHPLA
TLEVAITGTRRMLELAQEHNARFTFFSSSEIYGDPDPKHVPTPESYRGHVSCQGPRACYD
ESKRVGETLCYIFHGEHGTKTNTIRPFNVFGPGMQETDYRVLPNFANRIKGGHPLNVYGS
GNQTRTFCYITDAMVGFLLVILRGVPGEAYNIGNPKPEISMVDLVNRISEVIGKPVAHNV
IEYPDSYPADEPNRRCPDIRKAKLQLKFEPSVDLNEGLRRFLTWADGVYTGEQ