Protein Info for AMB_RS00675 in Magnetospirillum magneticum AMB-1

Annotation: KR domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 7 to 185 (179 residues), 158.4 bits, see alignment E=3.1e-50 PF01370: Epimerase" amino acids 9 to 175 (167 residues), 27.9 bits, see alignment E=3.1e-10 PF08659: KR" amino acids 10 to 159 (150 residues), 29.4 bits, see alignment E=1.5e-10 PF13561: adh_short_C2" amino acids 16 to 236 (221 residues), 173.4 bits, see alignment E=1.2e-54

Best Hits

Swiss-Prot: 41% identical to PHAB_SYNY3: Acetoacetyl-CoA reductase (phaB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to mag:amb0134)

MetaCyc: 33% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB37 at UniProt or InterPro

Protein Sequence (238 amino acids)

>AMB_RS00675 KR domain-containing protein (Magnetospirillum magneticum AMB-1)
MTSLAGKLALVTGGTRGIGAAIAARLLADGAKVMVTGTRPGGEGPAGSGYLAVDFADAAA
TTAFAEQAAGLGVDILVNNAGINKVSPFAEIDPADFARIQQVNVTAPFLLARAVVPGMQA
KAWGRIVTVSSIWGRISRAGRGAYSASKFAVDGLTAALAAEVAQFGILANCVAPGFIDTE
LTRQVLGEDGIKELTAQVPARRLGRPEEIAAFVAWLAGPENSYISGQNLVIDGGFTRV