Protein Info for AMB_RS00615 in Magnetospirillum magneticum AMB-1

Annotation: nucleoside-diphosphate sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF05368: NmrA" amino acids 6 to 117 (112 residues), 28.1 bits, see alignment E=6.1e-10 PF04321: RmlD_sub_bind" amino acids 7 to 159 (153 residues), 29.4 bits, see alignment E=1.8e-10 PF01370: Epimerase" amino acids 7 to 242 (236 residues), 113.8 bits, see alignment E=3.7e-36 PF16363: GDP_Man_Dehyd" amino acids 8 to 261 (254 residues), 65.9 bits, see alignment E=1.8e-21 PF01073: 3Beta_HSD" amino acids 9 to 174 (166 residues), 54.3 bits, see alignment E=4.5e-18 PF13460: NAD_binding_10" amino acids 11 to 153 (143 residues), 40.2 bits, see alignment E=1.4e-13 PF02719: Polysacc_synt_2" amino acids 57 to 175 (119 residues), 21.3 bits, see alignment E=5.5e-08

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to mag:amb0122)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB49 at UniProt or InterPro

Protein Sequence (318 amino acids)

>AMB_RS00615 nucleoside-diphosphate sugar epimerase (Magnetospirillum magneticum AMB-1)
MSKGSPILLTGGFGYLGGRIARHLLAQGKKVRITTRRGPESWPDWAKDAEVVRLKPSDDT
ALLAACQGVSALVHLSAMNEVDCTTDPVGALEANGVDTVRLLQAALKAGVGRFVYFSTAR
VYGEPLIGRIEESMICRPVHPYGISHKVAEDYILAEHAKGRIQAACLRLSNALGAPADPL
INRWTLVANDLCRQAASTGKMVLKSSGVALRDFIPMAEVARAVQVLLEVDGPKLGDGIFN
LGVGHSSSIRDLADLILARAEAVLGTRPVLERPDPKPGEVADPLDFRVDRLAAAGFAASR
DLAPEIDQTLILCRKAFG