Protein Info for AMB_RS00555 in Magnetospirillum magneticum AMB-1

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 177 to 187 (11 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 261 to 287 (27 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 4 to 165 (162 residues), 92.2 bits, see alignment E=1.9e-30

Best Hits

Swiss-Prot: 40% identical to YKCC_BACSU: Uncharacterized glycosyltransferase YkcC (ykcC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to mag:amb0110)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB61 at UniProt or InterPro

Protein Sequence (313 amino acids)

>AMB_RS00555 glycosyltransferase (Magnetospirillum magneticum AMB-1)
MLLSVVSPAHNEEQNLPVLHQRLKETLDQAGIQWEWVVVDDHSSDSTFQILTGLADVDSR
VRAIRFSRNFGSHKAILCGLQEARGDCAVVMSSDLQDPPEVILSLLEEWRRVGSQVVWAE
REARGDTGANLWFAKLYYWLMRRVVDLPNLPPNGADVFLLDRFVVDTLLRFNEQHVSLIA
LLSWVGFRQSSILYRRGERLHGSSSWSLAKKLKLVIDSVTGFSYLPIRLMSGVGLVTALM
GFAYALVVIGARLFGGQPEGWSSLMVVLLVIGGIQMVMMGILGEYLWRALDQSRQRPPFV
VEAKKTTPPSSRP