Protein Info for AMB_RS00535 in Magnetospirillum magneticum AMB-1

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF00132: Hexapep" amino acids 25 to 58 (34 residues), 35 bits, see alignment 8e-13 amino acids 102 to 136 (35 residues), 30.6 bits, see alignment 2e-11 PF14602: Hexapep_2" amino acids 27 to 53 (27 residues), 13.1 bits, see alignment 6.6e-06 amino acids 107 to 136 (30 residues), 16.9 bits, see alignment 4.4e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0106)

Predicted SEED Role

"N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)" in subsystem Peptidoglycan Biosynthesis or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.3.1.157, EC 2.7.7.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.157, 2.7.7.23

Use Curated BLAST to search for 2.3.1.157 or 2.7.7.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB65 at UniProt or InterPro

Protein Sequence (159 amino acids)

>AMB_RS00535 N-acetyltransferase (Magnetospirillum magneticum AMB-1)
MPVTETVTLGKDVRIFQPDLVNLYGCSIGDETKIGAFVEIQGGATIGARCKISSHSFVCE
GVTIEDEVFVGHGVMFTNDVYPRATTPDGALATAADWTCSPTVVKRRASIGSGATILPNL
TIGENALVAAGAVVTKDVPANAIVAGVPAVVVGEVADKR