Protein Info for AMB_RS00525 in Magnetospirillum magneticum AMB-1

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 12 to 55 (44 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 164 to 192 (29 residues), see Phobius details amino acids 204 to 232 (29 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 347 to 371 (25 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details PF04932: Wzy_C" amino acids 208 to 361 (154 residues), 37.1 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb0104)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WB67 at UniProt or InterPro

Protein Sequence (432 amino acids)

>AMB_RS00525 O-antigen ligase family protein (Magnetospirillum magneticum AMB-1)
MMEIVGKIRRAMASPWDASHILALAALVAPGIGMLAPLGMAPLFIATVLGILLLEWRQRL
WTAFPRFLGLILCMICGWAGLTALWAVDPARSLLAAAQLALNTLGGVILIGAAKRLRSQA
AAKVGAALMIGIVLGMGLFVIGLVSGRRLEALLRAMQNRDLLPYYWVSIQVFNRGVCVTA
LAALPAMALLWVERRQRQLAATGIPVVTMMIISKALAAKVLLGIELAALALFRKPSRLLG
ITVGAFLAALVVFIPLGTRMLPPPQVSANWAFVPYSSHHRLTIWGFVTDRIFERPVLGWG
MDSARAIPGGEDDEIVYFEFRHGSDGSSRAEVAEQHLPLHPHNAVLQWWLELGGVGALLF
AVLLARLGWLAVGPRQSPAMAVCGGALLVGACVVSSVSFGFWQSWWQCTMWFLAAWATAL
APLLSPSQMRDE