Protein Info for AMB_RS00295 in Magnetospirillum magneticum AMB-1

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 11 to 343 (333 residues), 453.6 bits, see alignment E=1.7e-140 PF04321: RmlD_sub_bind" amino acids 11 to 278 (268 residues), 61.6 bits, see alignment E=2.4e-20 PF01370: Epimerase" amino acids 12 to 258 (247 residues), 230.5 bits, see alignment E=7.1e-72 PF02719: Polysacc_synt_2" amino acids 12 to 123 (112 residues), 48.5 bits, see alignment E=2.5e-16 PF01073: 3Beta_HSD" amino acids 13 to 176 (164 residues), 41.9 bits, see alignment E=2.4e-14 PF16363: GDP_Man_Dehyd" amino acids 13 to 331 (319 residues), 286.2 bits, see alignment E=1.6e-88 PF07993: NAD_binding_4" amino acids 83 to 195 (113 residues), 30.8 bits, see alignment E=5.9e-11

Best Hits

Swiss-Prot: 60% identical to RMLB_NEIGO: dTDP-glucose 4,6-dehydratase (rfbB) from Neisseria gonorrhoeae

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to mag:amb0058)

MetaCyc: 54% identical to dTDP-glucose 4,6-dehydratase 1 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBB3 at UniProt or InterPro

Protein Sequence (372 amino acids)

>AMB_RS00295 dTDP-glucose 4,6-dehydratase (Magnetospirillum magneticum AMB-1)
MSEQSLKNTWRVLVTGGAGFIGSALVGQLLASGHSVLTFDKLTYAGHLANLDGWLDHPNH
SFVQGDIAERAQVEAVVEQFQPTTIMHLAAESHVDRSIASAGEFVRTNVIGTFTMLEAAA
AHRARLDGAARERFRFLHVSTDEVFGSLGPDEAFDENSRYQPNSPYSATKAASDHLARAW
SHTYGLPVLVSNCSNNYGPRQFPEKLIPLMILNAVEGKPLPVYGDGCQVRDWLHVEDHAR
ALATIVERGRPGEVYCVGGESERTNMEVVHTLCALLDGLRPRAEGRSHAELIRHVTDRPG
HDRRYAMNIARIRAELDWKPRETFESGLAKTVEWYLANGAWCAKVVADAASRLPRDLARK
TDGTLFERKASA