Protein Info for AMB_RS00090 in Magnetospirillum magneticum AMB-1

Annotation: DNA translocase FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 804 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details transmembrane" amino acids 78 to 103 (26 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details PF13491: FtsK_4TM" amino acids 25 to 178 (154 residues), 55.3 bits, see alignment E=1.7e-18 PF17854: FtsK_alpha" amino acids 309 to 409 (101 residues), 103.8 bits, see alignment E=1.2e-33 PF01580: FtsK_SpoIIIE" amino acids 417 to 636 (220 residues), 244.6 bits, see alignment E=2.1e-76 PF01935: DUF87" amino acids 443 to 493 (51 residues), 24 bits, see alignment 9.8e-09 PF09397: FtsK_gamma" amino acids 739 to 798 (60 residues), 93.1 bits, see alignment 1.7e-30

Best Hits

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to mag:amb0016)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBF5 at UniProt or InterPro

Protein Sequence (804 amino acids)

>AMB_RS00090 DNA translocase FtsK (Magnetospirillum magneticum AMB-1)
MAAPSRKTMPSGGFLPRGTVDFLRRRLTQMGGLLLLVLGAAGLAALLTADPHDSSFDTAA
SGPVLNALGRPGAWFADFLFQAVGWGGAILAMTWVVWGLLVLIRVRLPGRWALRLMILPP
TMVVWGLALAALPLPAMPSLPAGPGGALGLLLVKGLGLLLPPEFAWIAGPAASLVALAAS
VFVLGLTGAEWAGLGRRSLDMASAAGQAASALRAHPFADPEPGIRRVDPVLRPVPARAEP
VASPLPPDDEDDDDPFVPPPLDEGAEPARPSGSLVQPKRPPVTPGKRERAARQGTLDLGA
PPPGSGYQLPPLTLLAPAPDQGGARINQDGLAQNARLLEEVLSDFGVNGKVVKVRPGPVV
TLYELEPAPGTKTSRVIGLADDIARSMSALSVRIATVPGRSVIGIELPNQKRETVYLREL
LAAEQFEKASAKLTLVLGKDIGGAPVMVDLARMPHLLIAGTTGSGKSVAINTMILSLLYR
LTPEECRIIMIDPKMLELSVYDGIPHLLAPVVTEPGKAVVALKWAVREMEDRYRAMSQLG
VRNIAGYNHRLAEARDRGEVLTRTVQTGFDPDTGKPLYEEQTLALEPLPFIVVIVDEMAD
LMLVAGKDIEAAVQRLAQMARAAGIHILMATQRPSVDVITGTIKANFPTRISFQVTSKID
SRTILGEQGAEQLLGQGDMLYMASGGRVTRVHGPFVSDEEVEKVVEHLRSQGEPSYVEAV
TEEEQTEFGQGGGEGGGSGDDLYDQAVALVCRENKASTSFVQRHLQIGYNRAARLIERME
SEGVVGKPNHVGKREVLARTGVEY