Protein Info for AMB_RS00045 in Magnetospirillum magneticum AMB-1

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00085: Thioredoxin" amino acids 26 to 127 (102 residues), 97.2 bits, see alignment E=1.6e-31 TIGR01068: thioredoxin" amino acids 40 to 128 (89 residues), 106.3 bits, see alignment E=3.8e-35 PF13098: Thioredoxin_2" amino acids 41 to 124 (84 residues), 34.4 bits, see alignment E=7.3e-12 PF14559: TPR_19" amino acids 149 to 213 (65 residues), 53.8 bits, see alignment E=6.1e-18 PF14561: TPR_20" amino acids 225 to 309 (85 residues), 107.4 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 100% identity to mag:amb0007)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBG4 at UniProt or InterPro

Protein Sequence (310 amino acids)

>AMB_RS00045 thioredoxin (Magnetospirillum magneticum AMB-1)
MDLIFNSGAQGAAGAAQNVPGDLIKDTTTATFVADVIEMSQKVPVIVDFWATWCGPCKTL
GPALEKVVREARGAVRMVKVDVDKNQDLAAQLRIQSVPTVYAFKGGRPVDAFTGAQPESQ
LKAFVKKLMSGSNAGPTIDDYIAEAKRVLEEGDPQTAATIFNQILQEAPDNASAMAGLLR
CLIAVGQTAQAESMLGRLAPEIARHPDITAVATALELARHAGGVGEAAELRRRLAADPDD
HQARYDLALAYYAAGEVETAVDELLDLFKRDRAWNDDAARKQLVKIFEVLGFSHPLAKSG
RARLSTLLFS