Protein Info for AMB_RS00020 in Magnetospirillum magneticum AMB-1

Annotation: ParA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF10609: ParA" amino acids 10 to 52 (43 residues), 35.9 bits, see alignment 2.3e-12 PF13614: AAA_31" amino acids 10 to 184 (175 residues), 215.2 bits, see alignment E=2.7e-67 PF09140: MipZ" amino acids 10 to 163 (154 residues), 39.3 bits, see alignment E=1.9e-13 PF06564: CBP_BcsQ" amino acids 11 to 254 (244 residues), 46.9 bits, see alignment E=1.1e-15 PF01656: CbiA" amino acids 12 to 236 (225 residues), 111.2 bits, see alignment E=1.3e-35 PF02374: ArsA_ATPase" amino acids 17 to 53 (37 residues), 27.2 bits, see alignment 9.4e-10

Best Hits

Swiss-Prot: 64% identical to PARA_CAUVC: Chromosome partitioning protein ParA (parA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to mag:amb0004)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBG7 at UniProt or InterPro

Protein Sequence (265 amino acids)

>AMB_RS00020 ParA family protein (Magnetospirillum magneticum AMB-1)
MAEPSRSSARVIAVANQKGGVGKTTTAINLATAMAATKKTVLIIDLDPQGNASTGLGIDR
SARDVNSYHVLIGEAALADAVLTTSIPGLSLVPSGVDLSGAEIELVEFERREHRLKESLA
GSLGAYDYVLIDCPPSLNLLTLNALVAANAVMVPLQCEFFALEGVSHLIKTIERVRQAFN
PQLELQGIILTMFDKRNNLSDQVAADVRDYFGDKVYKTVIPRNVRVSEAPSHGKPVLLYD
MKCTGSEAYISLASEVLKRERELRA