Protein Info for AMB_RS00015 in Magnetospirillum magneticum AMB-1

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF02527: GidB" amino acids 23 to 186 (164 residues), 147.7 bits, see alignment E=1.2e-47 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 26 to 190 (165 residues), 129.4 bits, see alignment E=6e-42

Best Hits

Swiss-Prot: 100% identical to RSMG_MAGSA: Ribosomal RNA small subunit methyltransferase G (rsmG) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 100% identity to mag:amb0003)

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2WBG8 at UniProt or InterPro

Protein Sequence (210 amino acids)

>AMB_RS00015 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (Magnetospirillum magneticum AMB-1)
MGNRIVGPEELLTKSGVSRETLERLRLYADLLVKWQARINLVGPDTVPDLWSRHMLDSVQ
LFPLIKVGARRLVDLGSGAGFPGLVLAVMGAPDVHLVESDSRKCAFLREVARVTETPVTV
INKRIEQVAPLGADVVTARALAPLDRLLGWAFPHLAEGGECLFLKGRGAEDELTASAKEW
NITASRVPSLTDPGGLVLHLREVSRGRAQP