Protein Info for ABZR88_RS21760 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 92.7 bits, see alignment E=1.7e-30 PF00486: Trans_reg_C" amino acids 160 to 231 (72 residues), 71.2 bits, see alignment E=6.4e-24

Best Hits

Swiss-Prot: 35% identical to SRRA_STAAS: Transcriptional regulatory protein SrrA (srrA) from Staphylococcus aureus (strain MSSA476)

KEGG orthology group: K07658, two-component system, OmpR family, alkaline phosphatase synthesis response regulator PhoP (inferred from 39% identity to toc:Toce_0967)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>ABZR88_RS21760 response regulator transcription factor (Mucilaginibacter yixingensis YX-36 DSM 26809)
MRKNRLVIIDDQYDVLELLKYNFTREGYEVKYFFTAVDALKYITNDNTDLVLTDWVLPEM
DGLELCKNLKMSMATQDIPLVMLTGKNDEIDAVTALEVGADDYLVKPLRIKEMMTRVKKI
LRRKLADDTIKTTTVVQDKLDFGALRLDVIAYKVYLNNCELDLTIGEFKLLELLAKYPGK
VFSRNQIIEKINGPQYFATERSIDVQIVGLRKKLGIYKEAVETVRSVGYRFNVAPFKVE