Protein Info for ABZR88_RS21650 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: DNA replication/repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 363 (363 residues), 286.4 bits, see alignment E=1.8e-89 PF13175: AAA_15" amino acids 1 to 109 (109 residues), 39.2 bits, see alignment E=1.8e-13 PF02463: SMC_N" amino acids 2 to 342 (341 residues), 72.8 bits, see alignment E=7.2e-24 PF13555: AAA_29" amino acids 3 to 54 (52 residues), 31 bits, see alignment 4.4e-11 PF13476: AAA_23" amino acids 5 to 230 (226 residues), 43.9 bits, see alignment E=1.1e-14 PF13304: AAA_21" amino acids 25 to 49 (25 residues), 27.7 bits, see alignment (E = 6.4e-10)

Best Hits

Swiss-Prot: 51% identical to RECF_FLAPJ: DNA replication and repair protein RecF (recF) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 72% identity to psn:Pedsa_2653)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>ABZR88_RS21650 DNA replication/repair protein RecF (Mucilaginibacter yixingensis YX-36 DSM 26809)
MYLQQISVINFKNYAEAGLSFSQGVNALTGNNGAGKTNLLDAIHYLSLCKSYFNPIDSQQ
IKQGCDFFMISGVFDKGEQHDTVACGVKRNQKKQFKRNKKDYQRLADHIGLYPLVMISPY
DISIIIEGSEERRKFIDNVISQTDNRYLDELIIYNKILANRNALLKKIAETGRYDAGLLE
VLDEQLVASGNRIFEKRRAFMDEFTAIFAELYKYLTDEAEQVDLVYESQLLQTSFAELLI
KTTEKDRVLERTTAGIHRDDLAFMVHGMPMKKFGSQGQQKSFLIALKLAQYTFLHRHTGF
KPLLLLDDIFDKLDEHRITKLMQMVSNHDFGQVFITDTSTARVCQVFEKINVDVKLFEVE
GGLVNA