Protein Info for ABZR88_RS20510 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 208 (200 residues), 126.7 bits, E=1.3e-40
• PF08659: KR
  • amino acids 11 to 177 (167 residues), 31 bits, E=3.4e-11
• PF13561: adh_short_C2
  • amino acids 21 to 265 (245 residues), 151 bits, E=6.5e-48

Best Hits

KEGG orthology group: None (inferred from 72% identity to phe:Phep_1290)

Predicted SEED Role

"D-mannonate oxidoreductase (EC 1.1.1.57)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.57)

MetaCyc Pathways

• superpathway of hexuronide and hexuronate degradation (10/10 steps found)
• superpathway of β-D-glucuronosides degradation (7/7 steps found)
• D-fructuronate degradation (4/4 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.57

Use Curated BLAST to search for 1.1.1.57

Protein Sequence (270 amino acids)

>ABZR88_RS20510 SDR family oxidoreductase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MEEFSLKDKVIIVTGGTGILGDAFIKGIAKAGGTVGILGRNQAVAQERADAVVAAGGKAM
ALIADVMQEDQLIAAKNQIMDAYGRIDGLVNGAGGNMPGGIVQPGDDVFKLNMDGLRQVM
DLNLYGTLIPTQVFGEVMAQAGSGSIVNISSMASQRAITKVLGYTLAKTAVDAYTRWFAV
EMANRHGDKLRMNAIAPGFFLTEQNRTLLTQPDGGYTERGNLVLQNTPYKRFGEPDELIG
ALVWLLSDASKFVTGTVINVDGGFSVFSGV