Protein Info for ABZR88_RS20490 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: fibronectin type III domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00041: fn3" amino acids 41 to 119 (79 residues), 25.7 bits, see alignment E=4.8e-09 PF01436: NHL" amino acids 167 to 193 (27 residues), 31.2 bits, see alignment (E = 6.2e-11) amino acids 221 to 247 (27 residues), 26.4 bits, see alignment (E = 2.1e-09) amino acids 275 to 301 (27 residues), 22.6 bits, see alignment (E = 3.2e-08) amino acids 430 to 456 (27 residues), 34.7 bits, see alignment (E = 4.6e-12)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>ABZR88_RS20490 fibronectin type III domain-containing protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MRKRLPLLLLLAAALVPVMLLVQGCNKNNDSTPLTPYVTVNPIVSNLKDTTLRVDYQIQN
FVIGTVTSYGVCWSSSKNNPTTADSKNNVATSPSAVNYTATINGLTPNTLYYVRAYAVMN
STTYYSPAVQVTTLKTGGGNNMYGTVSTFAGQTTAGYSNGTGTAATLSNPQGIAVDNAGN
LYVADTYNNSIRKITPAGVVTYLAGTGAAGYADGNAASAQFYAPIGIAVDASGNVYVADA
GNNAIRKITTAGVVSTLAGGKFSGYVDSTGTNARFNAPTGVAVDASGNLYVTDRINSAIR
KVTPAGKVTTFAGTNTVGYVDSTGTSALFRSPTGIVIDGANLYVTDLGNYAIRKIVISSA
KVSTLLGNPTPSADVLNSPVAIASDQKGKLFITDQTGRILMIGTNNVLYNLGGNAATYGF
ADGDGTAAKFDSPQGLAVDASGNVYVADNNNNRIRKIVVKTAP