Protein Info for ABZR88_RS18630 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: LPS export ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 3 to 239 (237 residues), 370.8 bits, see alignment E=1.2e-115 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 120 bits, see alignment E=6.4e-39

Best Hits

Swiss-Prot: 57% identical to LPTB_ACIFR: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Acidithiobacillus ferrooxidans

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 87% identity to phe:Phep_3684)

MetaCyc: 54% identical to lipopolysaccharide transport system ATP binding protein LptB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>ABZR88_RS18630 LPS export ABC transporter ATP-binding protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MILRAEHLVKKYKQRTVVNDVTFNVSQGEIVGLLGPNGAGKTTSFYMIVGLIKPNEGQIF
LDDQNITTDAMYRRAQKGIGYLAQEASVFRKLSVEDNIKAILEMGPLSRERQEEKLEELI
DEFSLHKVRRNRGDLLSGGERRRTEIARALAAEPNFILLDEPFAGVDPIAVEEIQSLVAR
LKHKNIGILITDHNVQETLSITDRAYLLFEGKILKSGEPEDLAEDEMVRKVYLGSNFVLK
RKTFLPK