Protein Info for ABZR88_RS17430 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: UDP-glucose/GDP-mannose dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 181 (181 residues), 217.7 bits, E=3.1e-68
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 413 (413 residues), 446 bits, E=6e-138
• PF01210: NAD_Gly3P_dh_N
  • amino acids 2 to 153 (152 residues), 25.4 bits, E=3.7e-09
• PF03446: NAD_binding_2
  • amino acids 2 to 137 (136 residues), 21.3 bits, E=7.4e-08
• PF02558: ApbA
  • amino acids 3 to 108 (106 residues), 25.6 bits, E=2.6e-09
• PF00984: UDPG_MGDP_dh
  • amino acids 199 to 291 (93 residues), 126 bits, E=1.6e-40
• PF03720: UDPG_MGDP_dh_C
  • amino acids 315 to 416 (102 residues), 107.8 bits, E=1e-34

Best Hits

Swiss-Prot: 50% identical to UDG_PSEAE: UDP-glucose 6-dehydrogenase (udg) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 78% identity to phe:Phep_3615)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-xylose biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Protein Sequence (436 amino acids)

>ABZR88_RS17430 UDP-glucose/GDP-mannose dehydrogenase family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKIAVVGTGYVGLVTGTCLAETGNHVTCVDINVKKVEAMKRGELPIYEPGLELLFHRNIA
QNRLSFTTDLAEAIADAQIIFLALPTPPGGDGAADLSYVLGAAKDIALLLKEYKILVTKS
TVPVGTADKITAVLKANTNVEFAVVSNPEFLREGVAVDDFMKPDRVVIGTTDERARKLMG
ELYGPYVRQGNPIIFMDERSSELTKYAANSFLATKISFMNEIANLCELVGADVDMVRKGI
GSDDRIGKRFLFSGIGYGGSCFPKDVQALAKSAEDNKYDFKILNAVMDVNTIQKKLLVQK
LKAYYNGDLKGKHFALWGLAFKPETDDIREAPALYIIDELLAEGATVSAFDPEGMNNVKA
LLGDKITYGTNQYDVLQDADALLIVTEWSLFRTPDFDQIAQLLKSKVIFDGRNLYDLQKM
IDCGFYYNSIGRKIVS