Protein Info for ABZR88_RS16845 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: conjugal transfer protein MobC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details PF14293: YWFCY" amino acids 5 to 148 (144 residues), 168.6 bits, see alignment E=1.7e-53 PF02534: T4SS-DNA_transf" amino acids 165 to 557 (393 residues), 66.3 bits, see alignment E=5.2e-22 PF10412: TrwB_AAD_bind" amino acids 434 to 588 (155 residues), 43.7 bits, see alignment E=3.6e-15 PF12696: TraG-D_C" amino acids 459 to 569 (111 residues), 49.6 bits, see alignment E=7.8e-17

Best Hits

KEGG orthology group: None (inferred from 69% identity to zpr:ZPR_3421)

Predicted SEED Role

"Putative mobilization protein BF0133" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>ABZR88_RS16845 conjugal transfer protein MobC (Mucilaginibacter yixingensis YX-36 DSM 26809)
MQTGENDQAMRKILDMTRLISIVVLLLHFYVVCYGAFAGWHLVSALGDRLLGNVVRTGLF
SSFMKPKLIALAFLVIALIGVKGKKDEKQTGKTAALYLIIGLFFFFASQLVLLVRAKMTL
VAVAYMASCGLGFLLIMSGGTMLSKIIRDKLSGDIFNRDQETFPQEERLLENEFSVNLPV
KYILKGKERRGWINFINLFRALVVLGSPGSGKSYFIIRHIITQHIRKGFAMFVYDFKMPD
LAVIAYNTWLKYRDGYKVPPKFYSINFDDLSRSSRCNPLDPSAMLDLTDAVESARTILLG
LNREWIKRQGDFFVESPINFLTAIIWYLRKYNDGEFCTLPHVIELMQADYDSLFTLLSTQ
KEIDVLINPFISAYKRDAVEQLEGQIASAKITMAHIASPQLYYVLSGNEFTLDINNPAAP
KIVCMGNNPQKIQIYGAVLSLFTNRLLKIINQKDKLKCSLVFDEFPTLTTDIIPTISTGR
SNLISTCLGIQDASQLRKDYGREQADVIMNIVGNMAVGQVSGDTAKAVSEKIGRIMQDRE
SLSINRSDTSISRSKQLEAAVPASRISALSSGEFVGMVADNPDCKIELKAFHCEIVNDHA
ALKKEIDSYVPLPEVMKINNAIVERNYLEIKQDIRDIIELEMERLLSDPALAYLIIKKAG