Protein Info for ABZR88_RS12650 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF00072: Response_reg" amino acids 5 to 111 (107 residues), 87.5 bits, see alignment E=2.8e-28 PF00158: Sigma54_activat" amino acids 143 to 309 (167 residues), 238.3 bits, see alignment E=1.5e-74 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 73 bits, see alignment E=1.2e-23 PF07724: AAA_2" amino acids 166 to 293 (128 residues), 30.6 bits, see alignment E=1.3e-10 PF00004: AAA" amino acids 167 to 292 (126 residues), 26.3 bits, see alignment E=3.5e-09 PF07728: AAA_5" amino acids 167 to 287 (121 residues), 32 bits, see alignment E=4.5e-11 PF02954: HTH_8" amino acids 401 to 441 (41 residues), 49.8 bits, see alignment 9e-17

Best Hits

Swiss-Prot: 42% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 63% identity to phe:Phep_2510)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>ABZR88_RS12650 sigma-54 dependent transcriptional regulator (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKPNILIIDDETKLSALLSRIIELEGYRTFQAASAKEGLKLLAQETIHVVLSDVKLPDGS
GVELVKQIKEKKPYTEVICLTAYGTIHDGVAAIKNGAFDYITKGDDNDKILPLLAKATEK
AELQYRLYQIENRIIDQHSFDGIIGQSKAIHEAIDLAQKVAVTDTTVLLLGETGTGKEVF
AQAIHYNSNRKQKNFVAVNCSAFARDLLESELFGYKAGAFTNALKDKKGLFEEADGGTLF
LDEIGEMSIDLQAKLLRVLESGEYIKLGDTRTYKISVRIIAATNRNLQDEIQKGHFRQDL
YYRLSVFRIMLPSLNERKEDIPLLANYYLQEYAGKMNRKMDGIDPTMMRQLERYNWRGNI
RELKNLIERAVIVADGNTLKADLLPLDFYEAQDDGTPVFEMAEVEKNHIRKILAHTKGNK
TEAARLMNIGLTTLYRKLEEYQLG