Protein Info for ABZR88_RS12315 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF00892: EamA" amino acids 5 to 133 (129 residues), 32.2 bits, see alignment E=5.5e-12 amino acids 141 to 279 (139 residues), 72.8 bits, see alignment E=1.6e-24

Best Hits

KEGG orthology group: None (inferred from 65% identity to fjo:Fjoh_4038)

Predicted SEED Role

"FIG01092290: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>ABZR88_RS12315 DMT family transporter (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKKKYLLLQFAVVIAGFTGVFGKLISLDAVLLVWYRVAFSALGGLAVLTVVKPKVRLRMK
DRLKIGRVGLLLTAHWLFFYASIRYANISVGVVCFCLTSFFTAFLSPLINRKKFVYTEVF
FSMLTLAGISLIFGFDSSFRTGIILGVISSCFSALYTIFNERLVKHYDSRQINFYQMLSG
TIGLGVLLPLYLHFVPVKVLIPGLRDTVYLIFLALICTVGLYIMFAESLKRIPAFTVNMS
FNLEPVYSIILAFIIFGESKELNIGFYLGLAVVIASVFIQPFVAPVKKENTL