Protein Info for ABZR88_RS12160 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: carbohydrate binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02018: CBM_4_9" amino acids 56 to 198 (143 residues), 42.8 bits, see alignment E=3.4e-15

Best Hits

Predicted SEED Role

"Alpha-N-arabinofuranosidase (EC 3.2.1.55)" in subsystem L-Arabinose utilization (EC 3.2.1.55)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.55

Use Curated BLAST to search for 3.2.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>ABZR88_RS12160 carbohydrate binding domain-containing protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MRKLSQLSLLIVLCFITSKAVAQRGAAGGSKQISPDLFGIFFEDLSYAADGGLYAELVQN
RSFEYTPADKKGWNPLTAWDYTTEGFGYGELSVESSSPINVNNPHYIKLTISDPGQKGIG
VTNEGYDGIPVKAGEQYNFSLYARLMSADQIPLTVSLRGKKGEVYGEASIVAGAKDWKKY
SAVITANTTDADARLVVLAKRYPGIGHDIAVSTKNF