Protein Info for ABZR88_RS10215 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: peptide chain release factor N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00536: methyltransferase, HemK family" amino acids 3 to 280 (278 residues), 212.7 bits, see alignment E=5.7e-67 PF17827: PrmC_N" amino acids 7 to 77 (71 residues), 36.1 bits, see alignment E=5.1e-12 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 29 to 278 (250 residues), 255.1 bits, see alignment E=7.2e-80 PF02384: N6_Mtase" amino acids 101 to 203 (103 residues), 34.9 bits, see alignment E=7.1e-12 PF00891: Methyltransf_2" amino acids 104 to 185 (82 residues), 24.4 bits, see alignment E=1.1e-08 PF06325: PrmA" amino acids 106 to 188 (83 residues), 44.1 bits, see alignment E=1.3e-14 PF05175: MTS" amino acids 106 to 196 (91 residues), 65.7 bits, see alignment E=2.7e-21 PF10294: Methyltransf_16" amino acids 110 to 176 (67 residues), 23.6 bits, see alignment E=2.5e-08 PF02475: Met_10" amino acids 114 to 166 (53 residues), 21.5 bits, see alignment E=1.1e-07 PF13847: Methyltransf_31" amino acids 116 to 206 (91 residues), 42.8 bits, see alignment E=3e-14 PF13649: Methyltransf_25" amino acids 118 to 204 (87 residues), 47.4 bits, see alignment E=1.7e-15 PF08241: Methyltransf_11" amino acids 119 to 200 (82 residues), 28.7 bits, see alignment E=1.1e-09 PF08242: Methyltransf_12" amino acids 119 to 204 (86 residues), 42.6 bits, see alignment E=5.5e-14

Best Hits

Swiss-Prot: 45% identical to PRMC_FLAPJ: Release factor glutamine methyltransferase (prmC) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 45% identity to fps:FP2023)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>ABZR88_RS10215 peptide chain release factor N(5)-glutamine methyltransferase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKTVKDVFAEFKARLSELYATDETDAITSLVLSELIQTNKAKLKAFPELEIPESIGLQLT
DILSRLETGEPAQYILGETEFYGLPFKVSPAVLIPRPETEELVQWILDTTKQTPVKTILD
IGAGSGCIAIALKKHLPNVQVYAMDVSAAALNIAKQNAVLNEAEVHFIFDDILNPAEQLP
QFDIIVSNPPYVTLEDKEQMHRNVTDFEPHTALFVPQDDPLIFYRAITQFAAKKLNSNGY
LFFEINENYGEQTIDLINNNQFINSELRKDLTDRDRMTKAQLRG