Protein Info for ABZR88_RS09585 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: dihydrolipoamide acetyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF00364: Biotin_lipoyl" amino acids 6 to 77 (72 residues), 62.2 bits, see alignment E=5.2e-21 PF02817: E3_binding" amino acids 155 to 192 (38 residues), 35.4 bits, see alignment 1.5e-12 PF00198: 2-oxoacid_dh" amino acids 243 to 471 (229 residues), 268.5 bits, see alignment E=7e-84

Best Hits

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.168

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>ABZR88_RS09585 dihydrolipoamide acetyltransferase family protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MAKYQLLLPKMGESVAEATIIRWLKNPGDHVEADEAVMEIATDKVDSEVPSPVSGRLAER
LFNENDVVQVGAVVATIDTEERADTNAYKNDYVSFEEQPAAKPVAVPAPEPVNQSEAFDQ
QLAEVPVNEQAIPGINQLNSQPVVHAVSGNGNGRFYSPLVKNIAQHEGVTAAELDQIQGS
GAEGRLTKEDLLKYLSVRGSRPALHTEAAPQQSATPVAERPEPVAAQQPTPQPAKPAYSV
SGNDEIIEMDRMRRLIADHMVMSVQTSPHVTSFVEADVTNLVKWRDKVKSSFEKREGEKI
TFTPIFIEAVVKAIKDYPMVNVSVNGTQIIKKRDINIGMATALPSGNLIVPVIHKADGLN
LTGMAKTVNDLAARARANKLQPDEIKNGTFTITNVGSFGNVMGTPIINQPQVAILAVGAI
KKKPAVIETLEGDMIAIRHMMFLSLSYDHRVVDGALGGSFVRRVADYLENWDINTEI