Protein Info for ABZR88_RS09365 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 730 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 9 to 605 (597 residues), 668.2 bits, see alignment E=1e-204 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 11 to 463 (453 residues), 523.9 bits, see alignment E=3.9e-161 PF04851: ResIII" amino acids 24 to 182 (159 residues), 26.2 bits, see alignment E=2.4e-09 PF00270: DEAD" amino acids 24 to 187 (164 residues), 101.4 bits, see alignment E=1.7e-32 PF00271: Helicase_C" amino acids 219 to 329 (111 residues), 74.9 bits, see alignment E=2.1e-24 PF16124: RecQ_Zn_bind" amino acids 341 to 403 (63 residues), 59.6 bits, see alignment E=1.4e-19 PF09382: RQC" amino acids 406 to 507 (102 residues), 72.6 bits, see alignment E=8.9e-24 PF00570: HRDC" amino acids 536 to 602 (67 residues), 58.8 bits, see alignment E=1.5e-19 PF21220: RecQ-1-like_HTH" amino acids 626 to 676 (51 residues), 83.5 bits, see alignment 3.3e-27

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 78% identity to shg:Sph21_3364)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (730 amino acids)

>ABZR88_RS09365 DNA helicase RecQ (Mucilaginibacter yixingensis YX-36 DSM 26809)
METKKSLFDNLQNFFGFDNFKGEQEAIITNILSGNDTFVIMPTGGGKSMCYQLPALMSEG
TAIVISPLIALMKNQVDQLRAFGGSDSIAHFLNSSLTKSEIARVKDDVLSGKTKLLYVAP
ESLTKQDNIDFLRLNHVSFVAVDEAHCISEWGHDFRPEYRKIRQVISNIGENIPIIALTA
TATPKVQQDIQKNLQMNNATVYKSSFNRSNLFYEVRPKRNVLKEIIRFVKQHPGKSGIIY
CLSRKKVEEVAEALTLNGINAMPYHAGLDAKVRADTQDKFLMEEIDVIVATIAFGMGIDK
PDVRYVIHHDMPKSMEGYYQETGRSGRDGGEGICVAFYSEKDIDKLQKFMKDKPVSEREI
GTQILKEVIDYAESSVCRRKQILHYFGENFNEAGCNNMCDNCCATKQHFDGEEHLHKALS
LIKKLGEKFDDHHVVSLLMGTDNPQIHHYEHHLIDEFGSGKDQGEIVWQSLLRQAMLDNY
LLKDIDHYGLLKLTAKGHDFLENPHGIRFIMNRPVGATDDDESDDNPKQAASALDTQLLQ
MLKDLRKKVAKQKGLPPFVIFQDPSLEEMCTHYPITTDELKQISGVGVGKAMKFGAPFTE
LIKKYVEENDIDRPVDMVIKSAANKSALKVYIIQNIDRHLDLEDIAASKGITYEDVLREV
ETIVNSGTKLNLNYYIDEVIDEDKQEEVYDYFKSADSDSIDNALSELGSDDYTREEVQLM
RIKFMSELGN