Protein Info for ABZR88_RS09335 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: low specificity L-threonine aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01212: Beta_elim_lyase
  • amino acids 6 to 289 (284 residues), 316.7 bits, E=1.4e-98
• PF00155: Aminotran_1_2
  • amino acids 35 to 333 (299 residues), 35.6 bits, E=6.4e-13

Best Hits

KEGG orthology group: K01620, threonine aldolase [EC: 4.1.2.5] (inferred from 74% identity to phe:Phep_3290)

Predicted SEED Role

"L-allo-threonine aldolase (EC 2.1.2.1)" in subsystem Threonine degradation (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• glycine biosynthesis IV (1/1 steps found)
• superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
• folate transformations II (plants) (8/11 steps found)
• L-threonine degradation IV (1/2 steps found)
• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• glycine betaine degradation III (4/7 steps found)
• photorespiration II (6/10 steps found)
• folate transformations I (8/13 steps found)
• glycine betaine degradation I (4/8 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• purine nucleobases degradation II (anaerobic) (10/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1 or 4.1.2.5

Protein Sequence (340 amino acids)

>ABZR88_RS09335 low specificity L-threonine aldolase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MQLTVDLRSDTVTKPTTGMLDAMMSAKVGDDVFGEDETVTALEQKAAAMFGMEAGLFCPS
GTMTNQIAIKCFTQPLDELIADQTAHVYRYEGGGIAFNSAVSTRLLNGDRGRVTAEMIEP
EINAENVHFPRTSLVVLENTVNKGGGSCYTLADIKPIADLCQKHSLKLHLDGARIFNALA
ATGDNAIDYGKYFNGISICLSKGLGAPVGSVLLASKETIQYARRVRKVLGGGMRQAGFLA
AAGIYALDHHVERLKIDHAHAQILGRALAQCSWVSHVVPPDTNIVLFDTAVPADDIIKKL
DQKGVRCMSTGPNRIRFVLHLDVHPEQVEYAVVVLRNLEI