Protein Info for ABZR88_RS07070 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: ABC-F family ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 PF00005: ABC_tran" amino acids 18 to 184 (167 residues), 78.2 bits, see alignment E=1.4e-25 amino acids 420 to 469 (50 residues), 29.1 bits, see alignment 2.2e-10 PF12848: ABC_tran_Xtn" amino acids 223 to 307 (85 residues), 73 bits, see alignment E=2.6e-24

Best Hits

Swiss-Prot: 62% identical to YKPA_BACSU: Uncharacterized ABC transporter ATP-binding protein YkpA (ykpA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 81% identity to shg:Sph21_2467)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>ABZR88_RS07070 ABC-F family ATP-binding cassette domain-containing protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MITVSNLSLRYGKRTLFEEVNLKFTQGNCYGIIGANGAGKSTFLKILSGEIDPSTGSVAF
TPGERMAVLKQNHYEFDEFPVIETVMMGHTELYKVMKEKDAIYLKEDFTDADGERAGELE
NLFAEMDGWNAESNAATLLSNLGIKEALHYKQLNELDGNEKVRVLLAQALFGKPDILLLD
EPTNDLDIHTISWLEDFLAGYEAIVLVVSHDRHFLDAVCTHVVDIDFAKMTIYSGNYTFW
YQSSQLALKQRADQNKKLEDKVKELQEFISRFSANASKSKQATSRKKALDKINLEEIKPS
NRKYPAIMFNQQSREAGDQILQIEGLGKTLNGEVLFEDINLHVNKGDNIAVLSNNSLATA
AFYDILTGRDTDYRGSFKWGVTVNLADIPNDNSEYFKGKDLNLIDWLREYSQGEKDDQFI
RGFLGRMLFSGEEVLKKSTVLSGGEKMRCMFSRMMLQQANVLLFDEPTNHLDLESITALN
NGMKDFKGTMLFTSRDHELTSTVATRIIELTPGGIVDKLMTYDEYIDSDVVQKQRESLYA
NA