Protein Info for ABZR88_RS05425 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: glycoside hydrolase family 28 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12708: Pectate_lyase_3" amino acids 30 to 83 (54 residues), 48.6 bits, see alignment 1.8e-16 PF00295: Glyco_hydro_28" amino acids 120 to 260 (141 residues), 28.7 bits, see alignment E=1.5e-10 PF05048: NosD" amino acids 150 to 261 (112 residues), 26.4 bits, see alignment E=9e-10 PF13229: Beta_helix" amino acids 154 to 262 (109 residues), 35.7 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: None (inferred from 53% identity to tsa:AciPR4_0852)

Predicted SEED Role

"Polygalacturonase (EC 3.2.1.15)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 3.2.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.15

Use Curated BLAST to search for 3.2.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>ABZR88_RS05425 glycoside hydrolase family 28 protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MKVSACLKMAFALCFAASVAAAQGKGIYYVTNYGAKGDGKTIDTKSINKAIDAAATAGGG
TVWFPAGSYLSGSIHLKSNISLYIDQGATIVAADYTPEAGYDKPENVVTNQYEDFGHRHW
HNSLIWGENLHDVSILGPGLLWGKGLERTNRINKMTDETFMNPNKTIALYKCHNVILRDF
SILHGGWFGILATATDNLTIDNLKMDTNRDGMDVDCCWNVRISNCSVNSPEDDGICLKSS
YGLNTGRATENVTITNCQVSGYDEGSFLDGTFKRTIDYGADGPTGRIKFGTESNGGFKNI
TISNCVFSYCRGLALETSDGALLEDVTINNITMRDITNSPIFVRLNGRMRAPATDTVGAL
RRVIISNVVCYNADPRQGALISGIPGHDINDLTLSNIRIYFKGGGTAEQAKIVVPELEKE
YPEPGRFKETPSYGFFVRHVNDLKMKDIEVHYMNTDQRPAFMFDSITGADLEHLRGQHPS
GVPTLVLNKVNGLALHNSPNIADTKTDHIDHKEL