Protein Info for ABZR88_RS05410 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 84 to 111 (28 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details PF05977: MFS_3" amino acids 2 to 403 (402 residues), 177.3 bits, see alignment E=4.4e-56 PF07690: MFS_1" amino acids 17 to 353 (337 residues), 97.9 bits, see alignment E=6.1e-32

Best Hits

KEGG orthology group: None (inferred from 60% identity to phe:Phep_3756)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>ABZR88_RS05410 MFS transporter (Mucilaginibacter yixingensis YX-36 DSM 26809)
MSTFRSFKYRNFKLFFYGQSVSLLGTWIQKTAVMWLVYRLTGSAMLLGITGFVSLIPSLI
LSPYTGSYVDRHDKFKVMKQTQLMAMLQAGALAAVVFFHFYNISTIIFLSLLQGLINAFD
VTCRQSMMIELVDDKADLPNAIALNSTMNNMARLVGPALAGILLSTFGEDFCFISNFLSY
APILICLYQMRINTVVTEKPQQHIWAELKEGLDYILSEKDILGLLGLCAVSSLLVIPFTT
LMPVFAKDVFHGNSGTFSLFESAVGLGSLFSAIYLARLKAADKLIGTILTASVVFSIGLL
IVAFAPVQHVAIAGMVIAGAGMMIQVSGINMYIQTHAQHHMRARAISYYVMAYLGITPVG
SLLIGWLAEVMPSRYVVSIEALSGLLAVGAYVGYRWYLQNRKAVANVYTVN