Protein Info for ABZR88_RS03285 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 13 to 30 (18 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details PF07584: BatA" amino acids 7 to 80 (74 residues), 36 bits, see alignment E=1.1e-12 PF00092: VWA" amino acids 95 to 286 (192 residues), 77 bits, see alignment E=3.2e-25 PF13519: VWA_2" amino acids 97 to 202 (106 residues), 63.6 bits, see alignment E=3.8e-21

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 72% identity to phe:Phep_1481)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABZR88_RS03285 VWA domain-containing protein (Mucilaginibacter yixingensis YX-36 DSM 26809)
MEWFKSLEFAHKGFFWALLLIPAMVGWYIWKQQRLYGTLSVPVIKGFDLPKKKLFTKMRH
SGIVLRCLGMIMLIVAMARPQSSLSWQDSTTEGIDIIIASDISASMLAEDFKPNRLEAGK
NIAIDFIKNRPNDRIGLVIFSGEAFTQCPLTIDHDVLVNLYNDIHNGMIQDGTAIGMGLA
TAVNRIKDSKAKSKVIILLTDGSNNAGSIPPLTAAEIAHQFGIRVYAVGIGTTGFAPYPV
PTPMGVQYQRIPVDIDEGTLSKIANATGGKYFRATNNQALQSIYSQIDKLEKAKIDVTQY
HKKTECFFPFALLGLVFLLAEFISRNTLFKGALT