Protein Info for ABZR88_RS01520 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 424 (387 residues), 136.7 bits, see alignment E=4.3e-44 PF16576: HlyD_D23" amino acids 46 to 283 (238 residues), 72.5 bits, see alignment E=6.1e-24 PF13533: Biotin_lipoyl_2" amino acids 62 to 95 (34 residues), 39 bits, see alignment 1.1e-13 PF13437: HlyD_3" amino acids 200 to 323 (124 residues), 47.4 bits, see alignment E=5.4e-16

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 62% identity to psn:Pedsa_2438)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>ABZR88_RS01520 efflux RND transporter periplasmic adaptor subunit (Mucilaginibacter yixingensis YX-36 DSM 26809)
MGKTTKYILYGFGVLVVLLIVLKVTGVIGKPAKTKIATEKAVVRDITETVSASGKIKPEV
EVKISPEVSGEIVELPIKEGDVVKKGQLLCRIRPDILQSGYDRAVASYNTQKASVGNSKQ
MLAQAQATFDNVAAKYKRSKELYEAKVLTASEFDAARAEYAGAKASLEASKQNLTGAGYG
LAQTAASVKEANDNLAKTSIYAPVDGVVSKLSVEKGERVLGTQQFAGTEIMTISDLSAMD
VNVDVNENDINRVAIGDSSDIEIDAFNGKKFKGVVTEIGSSANVVGTNADQVTNFTVKVR
IDATSYANVMKKDAKNPSPFRPGLTSTVDIHTNKARALSVPIMSVTTREDSTKAKKDVDK
SAPKNDKAKTTNTPQVKTYVFVYDAGKVKQVPVTTGIQDDTYIQVFSGLKGGEEVVAGPF
EAISKTLKDKQEVEKVDKSNLYSGDKK