Protein Info for ABZR88_RS01345 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: purine-nucleoside phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01697: inosine/guanosine/xanthosine phosphorylase family
  • amino acids 22 to 268 (247 residues), 316.1 bits, E=1.5e-98
• TIGR01700: purine nucleoside phosphorylase I, inosine and guanosine-specific
  • amino acids 23 to 269 (247 residues), 327.4 bits, E=5.7e-102
• PF01048: PNP_UDP_1
  • amino acids 23 to 269 (247 residues), 179.3 bits, E=4e-57

Best Hits

Swiss-Prot: 50% identical to PUNA_BACSU: Purine nucleoside phosphorylase 1 (punA) from Bacillus subtilis (strain 168)

KEGG orthology group: K03783, purine-nucleoside phosphorylase [EC: 2.4.2.1] (inferred from 77% identity to psn:Pedsa_1335)

Predicted SEED Role

"Purine nucleoside phosphorylase (EC 2.4.2.1)" in subsystem Adenosyl nucleosidases or Deoxyribose and Deoxynucleoside Catabolism or Purine conversions (EC 2.4.2.1)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• adenine and adenosine salvage I (2/2 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• adenine and adenosine salvage III (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine deoxyribonucleosides degradation I (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• purine deoxyribonucleosides degradation II (2/3 steps found)
• pyrimidine deoxyribonucleosides degradation (2/3 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)
• purine ribonucleosides degradation (4/6 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• adenosine nucleotides degradation II (2/5 steps found)
• superpathway of purine deoxyribonucleosides degradation (3/7 steps found)
• ureide biosynthesis (3/7 steps found)
• nucleoside and nucleotide degradation (archaea) (5/10 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)
• fluoroacetate and fluorothreonine biosynthesis (1/6 steps found)
• nucleoside and nucleotide degradation (halobacteria) (1/6 steps found)
• arsenic detoxification (mammals) (7/17 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.1

Use Curated BLAST to search for 2.4.2.1

Protein Sequence (271 amino acids)

>ABZR88_RS01345 purine-nucleoside phosphorylase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MLESIEHTTAYIKSRIGDFEPEVGIILGTGLGKLVNEIEIEKQLMYSNIPDFPISTLEFH
AGKLIFGTLGGKKVVAMQGRLHYYEGYNMQQITFPVRVMKMLGIKVLLVSNASGALNPAF
KKGDLMVIEDHINLQPHNPLIGRNEEELGPRFPDMSEPYKLDLIQKALDIASAHQITCHK
GVYVAVTGPNLETRAEYKYLRIIGGDAVGMSTVPEVIVANHMGLPVFAISVLTDEGFPDT
LSPVSVDDILAIAQEAEPKMTQVLKELIAGL