Protein Info for ABZR88_RS01305 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03558: luciferase family oxidoreductase, group 1
  • amino acids 8 to 332 (325 residues), 378.8 bits, E=1.1e-117
• PF00296: Bac_luciferase
  • amino acids 15 to 308 (294 residues), 108 bits, E=3.2e-35

Best Hits

Swiss-Prot: 46% identical to YWCH_BACSU: Uncharacterized protein YwcH (ywcH) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 55% identity to cpi:Cpin_4929)

Predicted SEED Role

No annotation

Protein Sequence (340 amino acids)

>ABZR88_RS01305 LLM class flavin-dependent oxidoreductase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MSTKHIRLSVLDQSPIRKRATAVQAVRETIELAKLTEQLGYTRYWVAEHHNTGILAGSTP
EVLLGHLAAHTKTIRIGSGGIMLPNHSALQVAERFRMLEALAPGRVDLGMGRAPGTDRIT
ASVLNPSNQFREQDFIEQLYELNHYLHDTYEPGTIQQKIRAIPQVETVPSLWLLSSSGQS
GLFAAHFGMAFSFAHFINPFGGPEAVKTYRERFQPSADLAVPQANMAIFVFCSEDAEKVE
RHKAVMGHRFLQFEKGGPIVPLTYDDVKDVVYTDAEQDRLRYNRQRVVAGSPQFVKERLS
ALAESYGVDEIMMVTITEDFNDRLLSYELVARQFGLQPLV