Protein Info for ABZR88_RS01280 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: 50S ribosomal protein L13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01066: ribosomal protein uL13
  • amino acids 10 to 144 (135 residues), 198.4 bits, E=2.2e-63
• PF00572: Ribosomal_L13
  • amino acids 18 to 136 (119 residues), 160.8 bits, E=7e-52

Best Hits

Swiss-Prot: 55% identical to RL13_SYMTH: 50S ribosomal protein L13 (rplM) from Symbiobacterium thermophilum (strain T / IAM 14863)

KEGG orthology group: K02871, large subunit ribosomal protein L13 (inferred from 86% identity to phe:Phep_0110)

MetaCyc: 55% identical to 50S ribosomal subunit protein L13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L13p (L13Ae)" in subsystem Ribosome LSU bacterial

Protein Sequence (145 amino acids)

>ABZR88_RS01280 50S ribosomal protein L13 (Mucilaginibacter yixingensis YX-36 DSM 26809)
MNTLSYKTVSANKKTVNKEWVVVDAQGEILGRLSTKIAMIIRGKNKPSFTPNVDCGDNVI
VINADKVKLTGNKFNDKTYVSYTGYPGGQRFISPKELMAKHPERVIEKAVRGMLPKNRLG
RALFGNLYVYAGSEHPHAAQNPKTI