Protein Info for ABZR88_RS01200 in Mucilaginibacter yixingensis YX-36 DSM 26809

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 6 to 167 (162 residues), 209.1 bits, E=2.3e-66
• PF00156: Pribosyltran
  • amino acids 32 to 163 (132 residues), 48.2 bits, E=3.9e-17

Best Hits

Swiss-Prot: 54% identical to APT_CYTH3: Adenine phosphoribosyltransferase (apt) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 63% identity to shg:Sph21_2249)

MetaCyc: 48% identical to adenine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• adenine and adenosine salvage I (2/2 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• adenine salvage (2/3 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)
• adenine and adenosine salvage II (1/2 steps found)
• guanine and guanosine salvage II (1/2 steps found)
• glyphosate degradation III (2/7 steps found)
• (aminomethyl)phosphonate degradation (2/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Protein Sequence (175 amino acids)

>ABZR88_RS01200 adenine phosphoribosyltransferase (Mucilaginibacter yixingensis YX-36 DSM 26809)
MIEQRIKASIRDIHDFPKPGIIFKDITPILKDAQLCEGILDAFVEQLKGTEIDVVAGVES
RGFLFGLSLACRLGVPFVPVRKAGKLPYAIKQKVYELEYGQATIELHTDAFEPGARVLIH
DDLLATGGTVTAASELIAEMGGTVVGFSFVVGLGFLNGKEKIEPISENIVVLAGY