Protein Info for ABIE41_RS24155 in Bosea sp. OAE506

Annotation: TRAP transporter small permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details PF04290: DctQ" amino acids 22 to 151 (130 residues), 95 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 36% identical to Y1030_HAEIN: Putative TRAP transporter small permease protein HI_1030 (HI_1030) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 46% identity to put:PT7_3551)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>ABIE41_RS24155 TRAP transporter small permease (Bosea sp. OAE506)
MNLSRILLRQLENLLILAFAVMIAMVFGNVVLRYLFNSGITMSDEASRMIFVWLTFGGAF
LVALEGGHLGMTTVVQALGLRGRWLARLLAEALSLFCMGLLVWGCWQQSSLNMANLSPVM
GVPTAIFYVAGLACGLGIGLINLVTLVRLLTGRLPPGELVIGAESEEMAAFEAQSRERPR
P