Protein Info for ABIE41_RS21970 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 211 to 236 (26 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details PF12911: OppC_N" amino acids 24 to 70 (47 residues), 32.8 bits, see alignment 5e-12 PF00528: BPD_transp_1" amino acids 111 to 292 (182 residues), 113.8 bits, see alignment E=8.2e-37

Best Hits

Swiss-Prot: 44% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 65% identity to bpt:Bpet2850)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>ABIE41_RS21970 ABC transporter permease (Bosea sp. OAE506)
MTTAATDTLATPPELALRPRPGVLARLARNRSALIGGAIVLAFVLMAVLAPLLPIADPLK
SNFLAIRKPPSELYWFGTDELGRDQVSRLFYGAQASLLAGIISVLIALAVGVPFGLLAGW
YGGWIDAAISRVTEAMLACPFLILAIAFAAVLGPSLTNAMIAIGLSAVPIFVRLVRAQVM
SVKAEDFVEGARAVGARDLRIVVRHILPNILSPIVVQSTLFMAQAIILEAALSFLGLGQQ
PPAPSWGQMLNVAKNFMDQAPWMSVAPGVCIFLAVLGFNLLGDGLRDVLDPKEG